Gene Bio Systems
Recombinant Drosophila melanogaster Ribonuclease kappa(CG40127)
Recombinant Drosophila melanogaster Ribonuclease kappa(CG40127)
SKU:CSB-CF847594DLU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q8MSF5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRA YNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVTAN
Protein Names:Recommended name: Ribonuclease kappa Short name= RNase K Short name= RNase kappa EC= 3.1.-.-
Gene Names:ORF Names:CG40127
Expression Region:1-95
Sequence Info:full length protein
