
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q9VGA2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPS IAGSFAVWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCL VLAMIEGAGAAVATINAADKGAGIVIKPQRAQWEAILETIDPKRASSTQDFALAEFERVL DKCRASREPNLLQDIPVKSHERDSKQKPFYSLLDLVKLSQMF
Protein Names:Recommended name: Probable mitochondrial import inner membrane translocase subunit Tim17 3
Gene Names:Name:Tim17a1 ORF Names:CG10090
Expression Region:1-222
Sequence Info:full length protein
You may also like
-
Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 1(Tim17b1)
- Regular price
- €1.076,95 EUR
- Sale price
- €1.076,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 4(Tim17a2)
- Regular price
- €1.110,95 EUR
- Sale price
- €1.110,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit Tim22(Tim22)
- Regular price
- €1.088,95 EUR
- Sale price
- €1.088,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit TIM50-B(ttm2)
- Regular price
- €1.216,95 EUR
- Sale price
- €1.216,95 EUR
- Regular price
-
- Unit price
- per
Sold out