Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Gamma-secretase subunit Aph-1(aph-1)

Recombinant Drosophila melanogaster Gamma-secretase subunit Aph-1(aph-1)

SKU:CSB-CF892882DLU

Regular price €1.522,95 EUR
Regular price Sale price €1.522,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VQG2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALIPLKE FLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG MFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHI GYVVFSHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ

Protein Names:Recommended name: Gamma-secretase subunit Aph-1 Alternative name(s): Presenilin-stabilization factor

Gene Names:Name:aph-1 Synonyms:PSF ORF Names:CG2855

Expression Region:1-238

Sequence Info:full length protein

View full details