Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(CG13393)

Recombinant Drosophila melanogaster Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(CG13393)

SKU:CSB-CF894244DLU

Regular price €1.383,95 EUR
Regular price Sale price €1.383,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VLM5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFI STVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Short name= DAD-1 Short name= Defender against cell death 1 Short name= Oligosaccharyl transferase subunit DAD1 EC= 2.4.1.119

Gene Names:ORF Names:CG13393

Expression Region:1-112

Sequence Info:full length protein

View full details