Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Solute carrier family 2, facilitated glucose transporter member 4(SLC2A4)

Recombinant Dog Solute carrier family 2, facilitated glucose transporter member 4(SLC2A4)

SKU:CSB-CF895472DO

Regular price €1.449,95 EUR
Regular price Sale price €1.449,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:Q9XST2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TSIFETAGVGQPAYATIGAGVVNTVFTLVSVFLVERAGRRTLHLLGLAGMCGCAILMTIA LLLLERLPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFCNWTS NFIIGMGFQYIAXAMGPYVFLLFAVLLLAFFIFTFLKVPETR

Protein Names:Recommended name: Solute carrier family 2, facilitated glucose transporter member 4 Alternative name(s): Glucose transporter type 4, insulin-responsive Short name= GLUT-4

Gene Names:Name:SLC2A4 Synonyms:GLUT4 ORF Names:B146

Expression Region:1-162

Sequence Info:full length protein

View full details