Gene Bio Systems
Recombinant Dog Signal peptidase complex subunit 2(SPCS2)
Recombinant Dog Signal peptidase complex subunit 2(SPCS2)
SKU:CSB-CF634663DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:Q28250
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AAASAQGGRTGGGGGSSGPGGGPTCGSGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERKIK
Protein Names:Recommended name: Signal peptidase complex subunit 2 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 25 kDa subunit Short name= SPase 25 kDa subunit
Gene Names:Name:SPCS2 Synonyms:SPC25
Expression Region:2-226
Sequence Info:full length protein
