Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Major allergen Can f 1

Recombinant Dog Major allergen Can f 1

SKU:CSB-EP519455DO

Regular price €910,95 EUR
Regular price Sale price €910,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O18873

Gene Names: N/A

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ

Expression Region: 19-174aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.3 kDa

Alternative Name(s): Allergen Dog 1 Allergen: Can f 1

Relevance:

Reference: "The major dog allergens, Can f 1 and Can f 2, are salivary lipocalin proteins: cloning and immunological characterization of the recombinant forms."Konieczny A., Morgenstern J.P., Bizinkauskas C.B., Lilley C.H., Brauer A.W., Bond J.F., Aalberse R.C., Wallner B.P., Kasaian M.T.Immunology 92:577-586(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details