Gene Bio Systems
Recombinant Dog Keratinocyte-associated protein 2(KRTCAP2)
Recombinant Dog Keratinocyte-associated protein 2(KRTCAP2)
SKU:CSB-CF012692DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:P86229
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAT PVLTPAKVTGKGKKRN
Protein Names:Recommended name: Keratinocyte-associated protein 2 Short name= KCP-2
Gene Names:Name:KRTCAP2 Synonyms:KCP2
Expression Region:1-136
Sequence Info:Full length protein
