Skip to product information
1 of 1

GeneBio Systems

Recombinant Dog Interleukin-13 (IL13) (Active)

Recombinant Dog Interleukin-13 (IL13) (Active)

SKU:Q9N0W9

Regular price €400,95 EUR
Regular price Sale price €400,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: Q9N0W9

Gene Names: IL13

Alternative Name(s): Interleukin-13; IL-13

Abbreviation: Recombinant Dog IL13 protein (Active)

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

Source: Mammalian cell

Expression Region: 19-131aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR

MW: 14.0 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 3.930-20.07 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cytokine that plays important roles in allergic inflammation and immune response to parasite infection. Synergizes with IL2 in regulating interferon-gamma synthesis. Stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells.

Reference: Canine interleukin-13: molecular cloning of full-length cDNA and expression of biologically active recombinant protein. Yang S., Boroughs K.L., McDermott M.J. J. Interferon Cytokine Res. 20: 779-785 (2000)

Function:

View full details