Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog CD40 ligand(CD40LG)

Recombinant Dog CD40 ligand(CD40LG)

SKU:CSB-CF004937DO

Regular price €2.674,95 EUR
Regular price Sale price €2.674,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:O97626

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLYEDFVFMKTLQKCNKGEGSLSLLNCEEIKSQFEAFLKEIMLNNEMKKEENIAMQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLAVKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSRGSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL

Protein Names:Recommended name: CD40 ligand Short name= CD40-L Alternative name(s): Tumor necrosis factor ligand superfamily member 5 CD_antigen= CD154 Cleaved into the following 2 chains: 1. CD40 ligand, membrane form 2. CD40 ligand, soluble form

Gene Names:Name:CD40LG Synonyms:CD40L, TNFSF5

Expression Region:1-260

Sequence Info:full length protein

View full details