Recombinant Dog B-cell antigen receptor complex-associated protein alpha chain(CD79A)

SKU: CSB-CF004957DO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:P0CAN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LWVDGGPPSMTVSLGETARLQCLHNRSRLSSKLNITWWRVLQGNATWPDIFLSYGKGPNGELTIDTVNKSHMGMYRCQVEEKDLNQKILSSQQSCGTYLRVRERLPRPFLDMGEGTKNNIITAEGIILLFCAVVPGTLLLFRKRWQNMKFGVDAQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDGDVQLEKP

Protein Names:Recommended name: B-cell antigen receptor complex-associated protein alpha chain Alternative name(s): Ig-alpha CD_antigen= CD79a

Gene Names:Name:CD79A

Expression Region:33-236

Sequence Info:full length protein