Gene Bio Systems
Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit(vatP)
Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit(vatP)
SKU:CSB-CF345411DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:P54642
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFQLLSFLLSGEATAVERIITDACPVYAPFFGAMGVTAALVFTVMGAAYGTAKASVGISN MGVMKPDLVIKAFIPVIFAGVIAIYGLIICVILVGGIKPNANYTLMKSFTDLGAGLTVGL CGLAAGMAIGIVGDSGVRAFGQQPKLYVIMMLILIFSEALGLYGLIIGILLSSVSDTYCP GQALVPLNSGNVIGKN
Protein Names:Recommended name: V-type proton ATPase proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit
Gene Names:Name:vatP ORF Names:DDB_G0274381
Expression Region:1-196
Sequence Info:full length protein
