Recombinant Dictyostelium discoideum Superoxide-generating NADPH oxidase light chain subunit(cybA)

SKU: CSB-CF768141DKK

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q867X6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGKFKLGNWAAMIGMAACWCLIAGGIMGIWYERRYIAIYSICVGGVLYPLLYPLSFLGPL KAIFHQYYVAAALMAGLSVLCYFLVPTMLAAMVMDISAVVFLISAIKGERGDFFDKQD

Protein Names:Recommended name: Superoxide-generating NADPH oxidase light chain subunit Alternative name(s): Cytochrome b-245 light chain p22-phox Short name= p22phox

Gene Names:Name:cybA ORF Names:DDB_G0267460

Expression Region:1-118

Sequence Info:full length protein