Gene Bio Systems
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0292940(DDB_G0292940)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0292940(DDB_G0292940)
SKU:CSB-CF703654DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q54CM6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFIFFINTPTPPNIFFSKNIKIKKLMRFSCTEVCIFFSLIFFFFFFFFCVNWGCENNLLS RKYQMNRDTCNF
Protein Names:Recommended name: Putative uncharacterized protein DDB_G0292940
Gene Names:ORF Names:DDB_G0292940
Expression Region:1-72
Sequence Info:full length protein
