Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio vulgaris Protein DVU_0532 (DVU_0532)

Recombinant Desulfovibrio vulgaris Protein DVU_0532 (DVU_0532)

SKU:CSB-CF335825DDH

Regular price €1.506,95 EUR
Regular price Sale price €1.506,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303)

Uniprot NO.:P33392

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYAFLTGPMLWASLLVFFGGLLARVIWYIRGLDWRLDRVAYKPHLAIGLQGAVQSALKWL VPFGTYSWRQQPFFTVAFFLFHIGAVLVPLFLAGHNVILEERFGFSLPALPMGVADTLTV LAIIGLVMIALRRIALTEVRILTTGYDWFILAVSAAPFVTGFLARLHVGDYDTWLLAHII TGELFLIVAPFTKLSHIVLFFMSRGQLGMDYAIKRGGATRGPAFPW

Protein Names:Recommended name: Protein DVU_0532 Alternative name(s): HMC operon ORF 5

Gene Names:Ordered Locus Names:DVU_0532

Expression Region:1-226

Sequence Info:full length protein

View full details