Gene Bio Systems
Recombinant Desulfovibrio desulfuricans UPF0316 protein Dde_2502(Dde_2502)
Recombinant Desulfovibrio desulfuricans UPF0316 protein Dde_2502(Dde_2502)
SKU:CSB-CF657287DAAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Desulfovibrio desulfuricans (strain G20)
Uniprot NO.:Q30YE7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MITAASLLTALAVFIARLCDVCLGTIRHVMIIRGRRLLAFSVAFFEAVIWVYAVSRVIGA VSDPVTSLAFALGFASGTYAGITLEGVFKIGEQVVRVFTREGGPVACTLRDAGFRVTVFD GQGRDGVVNLLFVQVRRRQAGEVARIARNVDPECYMVVDDIRKTYTVGG
Protein Names:Recommended name: UPF0316 protein Dde_2502
Gene Names:Ordered Locus Names:Dde_2502
Expression Region:1-169
Sequence Info:full length protein
