Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfotomaculum reducens UPF0059 membrane protein Dred_3165 (Dred_3165)

Recombinant Desulfotomaculum reducens UPF0059 membrane protein Dred_3165 (Dred_3165)

SKU:CSB-CF393114DHX

Regular price €1.456,95 EUR
Regular price Sale price €1.456,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfotomaculum reducens (strain MI-1)

Uniprot NO.:A4J9B4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLFTLFALAVALGTDAFSLCIGIGIAGVNRRQIALISLTVLIFHILMPLLGWYAGGFLG SKMGQAASIAGALLLLYLGGKMIWDTIKPGKDEGPRFVITNTGGLLLLSASVSMDALSVG FTLGTQQVSLVLAAGVIGLVAGMMTFAGLTLGKYVGDWIGERAELVGGIILVGIGVKLFF

Protein Names:Recommended name: UPF0059 membrane protein Dred_3165

Gene Names:Ordered Locus Names:Dred_3165

Expression Region:1-180

Sequence Info:full length protein

View full details