Gene Bio Systems
Recombinant Deinococcus radiodurans Sulfoxide reductase heme-binding subunit YedZ(yedZ)
Recombinant Deinococcus radiodurans Sulfoxide reductase heme-binding subunit YedZ(yedZ)
SKU:CSB-CF870906DJA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Uniprot NO.:Q9RRF5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MARRPPPYAWLGPGVVLGGLLPTVFLLWDALSGGLGANPVKQATHQTGQLALIVLTLSLA CTPARVWLGWTWAARIRKALGLLAAFYAVLHFGIYLRGQDFSLGRIWEDVTERPFITSGF AALLLLLPLVLTSGKGSVRRLGFARWTLLHRLVYLAAALGALHYWWGVKKDHSGPLLAVL VLAALGLARLKTPARLNRPARQ
Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ
Gene Names:Name:yedZ Ordered Locus Names:DR_2537
Expression Region:1-202
Sequence Info:full length protein
