Gene Bio Systems
Recombinant Deinococcus radiodurans Protein CrcB homolog(crcB)
Recombinant Deinococcus radiodurans Protein CrcB homolog(crcB)
SKU:CSB-CF865781DJA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Uniprot NO.:Q9RXX0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFPLWLWLALGGAVGAVCRQAAVLLLAPLVARTGFPAAVLLINVLGSFLLGLTLALTGR GVWPEAVRMTFGTGVLGAFTTFSTFSTELDGLLLRGQGGLALAYAALSVGLGLTAAVAGR VLGARL
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:DR_0185
Expression Region:1-126
Sequence Info:full length protein
