Skip to product information
1 of 1

Gene Bio Systems

Recombinant Deinococcus radiodurans Potassium-transporting ATPase C chain(kdpC)

Recombinant Deinococcus radiodurans Potassium-transporting ATPase C chain(kdpC)

SKU:CSB-CF879651DJA

Regular price €1.337,95 EUR
Regular price Sale price €1.337,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RZN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTPNANLQNSAPLPAERPTPLPRLLLSALLAAVLFMLVCGLAYPLLTTVVAGAAFPNQA GGSLVTRNGQVVGSAVLGQNFTAPRYLHGRPSMTSKTDGSGPEPYNAENSGASNWGPTNA KLQGAVQGRIAAFRQENGLGADVPVPIDAVTASASGLDPDVTLATALLQVNRIAQARGMQ PAGVEKVIRAHLKGRDLGLLGEPRVNVLAVNLSLDGQ

Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain

Gene Names:Name:kdpC Ordered Locus Names:DR_B0087

Expression Region:1-217

Sequence Info:full length protein

View full details