Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dehalococcoides ethenogenes Glycerol-3-phosphate acyltransferase 2(plsY2)

Recombinant Dehalococcoides ethenogenes Glycerol-3-phosphate acyltransferase 2(plsY2)

SKU:CSB-CF676944DAAI

Regular price €1.491,95 EUR
Regular price Sale price €1.491,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dehalococcoides ethenogenes (strain 195)

Uniprot NO.:Q3Z7W1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSLIMVIIALIAAYFIGSTPAPYLAGRIFKGIDIRTVGSKNMGSMNVFYNVGFWPGILV LAVDIGKGALAMAVANWLGEGLGIQMLCALMAIAGHNYPVWLKFKGGKGGATAIGILAYL MPEGIPIYIACFLVLMAITRFPTLSYGISFLSFILVAWLGQHDLGKVLFSLLVVMIPIIM YIPRMKEIKNKAGSGNAKRAIFRKNLKERL

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY2 Ordered Locus Names:DET0965

Expression Region:1-210

Sequence Info:full length protein

View full details