Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Transmembrane protein 47(tmem47)

Recombinant Danio rerio Transmembrane protein 47(tmem47)

SKU:CSB-CF023845DIL

Regular price €1.464,95 EUR
Regular price Sale price €1.464,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6PFT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASSVSGAEEVRVSALTPLKLVGLVCVFLALCLDVGAVLSPAWVTADDQYHLSLWKSCSK PAASATWRCNSTLGTDWQIATLALLLGGAFLILLSFLVALVSVCIRSRRRFYRPVAIMLF AAVVLQACCLVLYPIKFIETISLRIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY Y

Protein Names:Recommended name: Transmembrane protein 47 Alternative name(s): Transmembrane 4 superfamily member 10

Gene Names:Name:tmem47 Synonyms:tm4sf10 ORF Names:zgc:63990

Expression Region:1-181

Sequence Info:full length protein

View full details