Gene Bio Systems
Recombinant Danio rerio Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhdb)
Recombinant Danio rerio Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhdb)
SKU:CSB-CF734666DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q68FN7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AVQQKDHDCSYLISARIHATPSNYAGSGSKAATMHWTGERILSIALLSLAPVAYFCPSPA VDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANAGLFVLSTVTFAGLCYFNYHDVGIC KAVALLWSK
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial Short name= CybS-B Alternative name(s): Succinate dehydrogenase complex subunit D-B Succinate-ubiquinone oxidoreductase cytochrome b smal
Gene Names:Name:sdhdb Synonyms:sdhd, sdhda ORF Names:zgc:100986
Expression Region:30-158
Sequence Info:full length protein
![Recombinant Danio rerio Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhdb)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_64d585ac-2c78-4348-aff6-6b60e894f2eb.jpg?v=1659246272&width=1445)