Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Post-GPI attachment to proteins factor 2(pgap2)

Recombinant Danio rerio Post-GPI attachment to proteins factor 2(pgap2)

SKU:CSB-CF685601DIL

Regular price €1.514,95 EUR
Regular price Sale price €1.514,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q5BL33

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQQVPYGSVDRDKPLIRVPFTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNY LPSISAAISLTPERYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQLLSGFTFLLA LSENVGLLLLTYVSSTETYSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSY WFKLRLFLFNGGCCVLAVYFYRRHNTYCEEGITHASRCVSIWWCCPTWPST

Protein Names:Recommended name: Post-GPI attachment to proteins factor 2 Alternative name(s): FGF receptor-activating protein 1

Gene Names:Name:pgap2 Synonyms:frag1 ORF Names:zgc:101568

Expression Region:1-231

Sequence Info:full length protein

View full details