Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Neurexin-3a-beta(nrxn3a)

Recombinant Danio rerio Neurexin-3a-beta(nrxn3a)

SKU:CSB-CF382352DIL

Regular price €1.420,95 EUR
Regular price Sale price €1.420,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A1XQY0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KPQPDIVLLPLPTSYEVDNTKMKSPLITSPMFRNVPTAIPTEPGIRRVPGASEVVRESSS TTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYITNSAQSNGAVMKDKQQS TKSGNKKQKNKDKEYYV

Protein Names:Recommended name: Neurexin-3a-beta Alternative name(s): Neurexin IIIb-beta Cleaved into the following 2 chains: 1. Neurexin-3a-beta, soluble form 2. Neurexin-3a-beta, C-terminal fragment Short name= 3. NRXN3-CTF

Gene Names:Name:nrxn3a

Expression Region:536-672

Sequence Info:full length protein

View full details