Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Leukocyte cell-derived chemotaxin 1(lect1)

Recombinant Danio rerio Leukocyte cell-derived chemotaxin 1(lect1)

SKU:CSB-CF350134DIL

Regular price €1.248,95 EUR
Regular price Sale price €1.248,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:P58239

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SATRMRRQTSAGVNRQPARRRNSTASARDERPTGPEYNPENPYHQNQGSEGTMVFDPMLD HRGICCTECHRSYTHCERVCEPLGGYWPWPYNYHGCRPVCRLIMPCRWWAARVLGLV

Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondromodulin-1 Alternative name(s): Chondromodulin-I Short name= ChM-I

Gene Names:Name:lect1 Synonyms:chm1, chmi

Expression Region:170-286

Sequence Info:full length protein

View full details