Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio ER lumen protein retaining receptor 3(kdelr3)

Recombinant Danio rerio ER lumen protein retaining receptor 3(kdelr3)

SKU:CSB-CF740781DIL

Regular price €1.499,95 EUR
Regular price Sale price €1.499,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6PFS5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRLSGDVCHLIAIIILFLKIWRSKSCAGISGKSQVLFALVFTTRYLDLFTSYISAYN TVMKVVYLLLAYSTVGLIFFRFRNSYDSESDSFRVEFLLVPVAGLSFLENYAFTPLEILW TFSIYLESVAILPQLFMITKTGEAESITAHYLLFLGLYRALYLANWLWRFHTEGFYDQIA VVSGVVQTIFYCDFFYLYFTRVLRGSGKMSLPMPV

Protein Names:Recommended name: ER lumen protein retaining receptor 3 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 3 Short name= KDEL receptor 3

Gene Names:Name:kdelr3 ORF Names:zgc:64171

Expression Region:1-215

Sequence Info:full length protein

View full details