Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Cytochrome c oxidase assembly protein COX14 homolog (si:dkey-222f2.8)

Recombinant Danio rerio Cytochrome c oxidase assembly protein COX14 homolog (si:dkey-222f2.8)

SKU:CSB-CF424329DIL

Regular price €1.345,95 EUR
Regular price Sale price €1.345,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A8E7D3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSGKRIADVGYRLFSGSMMLLTVYGGYLCVVRAQRYMQRKKQLELAAQSENTASEIIKE

Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX14 homolog

Gene Names:ORF Names:si:dkey-222f2.8

Expression Region:1-60

Sequence Info:full length protein

View full details