Recombinant Danio rerio  Cysteine-rich and transmembrane domain-containing protein 1(cystm1)

Recombinant Danio rerio Cysteine-rich and transmembrane domain-containing protein 1(cystm1)

CSB-CF403961DIL
Regular price
€1.008,95 EUR
Sale price
€1.008,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A5PLE2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNYEQPPAYTGPGPAPGYPAQGYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGYPNYPPGP PGPYTAQPGYQGYPQPGPPTNTVYVVEQGRRDDQSGEQACLATCWAALCCCCLCDMLT

Protein Names:Recommended name: Cysteine-rich and transmembrane domain-containing protein 1

Gene Names:Name:cystm1 ORF Names:zgc:165573

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share