Gene Bio Systems
Recombinant Dactylis glomerata Major pollen allergen Dac g 4
Recombinant Dactylis glomerata Major pollen allergen Dac g 4
SKU:CSB-EP307868DAC
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P82946
Gene Names: N/A
Organism: Dactylis glomerata (Orchard grass) (Cock's-foot grass)
AA Sequence: DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP
Expression Region: 1-55aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 22.4 kDa
Alternative Name(s):
Relevance:
Reference: Characterization of Dac g 4, a major basic allergen from Dactylis glomerata pollen.Leduc-Brodard V., Inacio F., Jaquinod M., Forest E., David B., Peltre G.J. Allergy Clin. Immunol. 98:1065-1072(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
