Gene Bio Systems
Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle(petC-1)
Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle(petC-1)
SKU:CSB-CF691521DZX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cyanophora paradoxa
Uniprot NO.:Q5CC93
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CSAASDDVPDMGKRKLMNLLLLGAIAGPVAGAGGPFVSFLVPPKAGGGAGAGQAAKDALG NDVKVSSWLETHKPGDRSLAQGLKGDATYLIVKEDGTLENYGLNAVCTHLGCVVPWNASE NKFMCPCHGSQYDRTGKVVRGPAPLSLALAHVSVLEDGVVAFEPWTETDFRTNTAPWWK
Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1 Rieske iron-sulfur protein 1 Short name= ISP 1 S
Gene Names:Name:petC-1
Expression Region:61-239
Sequence Info:full length protein
