Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cupriavidus pinatubonensis Protein CrcB homolog(crcB)

Recombinant Cupriavidus pinatubonensis Protein CrcB homolog(crcB)

SKU:CSB-CF672844DZR

Regular price €1.413,95 EUR
Regular price Sale price €1.413,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha)

Uniprot NO.:Q46ZT1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGPLGFVAVGIGAAVGAWLRWGLSVMWNALNPALPYGTLAANLLGGYLIGLAVGFFDTHP GLPPEWRLLAITGFLGGLTTFSTFSSEALANLISGDYGWALLHLLSHLGGSLLFAALGLW TYRLLA

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:Reut_A1988

Expression Region:1-126

Sequence Info:full length protein

View full details