Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cupriavidus necator Lipoprotein signal peptidase(lspA)

Recombinant Cupriavidus necator Lipoprotein signal peptidase(lspA)

SKU:CSB-CF608045DZQ

Regular price €1.459,95 EUR
Regular price Sale price €1.459,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)

Uniprot NO.:Q0K799

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASTTSRSARPARRNNKAASTTPLLWMAFALLVVVLDQFFKIVIVRTFTYGESRPVTGFF NLVLVYNKGAAFSFLADAGGWQRWFFTGLGIVVGAFIVWLLYRHTGQRLFCFAVSLILGG AVGNVIDRVVYGHVVDFLDFYVRNYHWPAFNVADCAITVGAVLLIVDELRRVRRH

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:H16_A3047

Expression Region:1-175

Sequence Info:full length protein

View full details