Gene Bio Systems
Recombinant Cupressus arizonica Pectate lyase 1
Recombinant Cupressus arizonica Pectate lyase 1
SKU:CSB-EP871029COAD
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q9SCG9
Gene Names: N/A
Organism: Cupressus arizonica (Arizona cypress) (Callitropsis arizonica)
AA Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
Expression Region: 22-367aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 42.6 kDa
Alternative Name(s): Major pollen allergen Cup a 1 Allergen: Cup a 1
Relevance: Has pectate lyase activity.
Reference: "A modified protocol for RNA isolation from high polysaccharide containing Cupressus arizonica pollen. Applications for RT-PCR and phage display library construction." Pico de Coana Y., Parody N., Fernandez-Caldas E., Alonso C. Mol. Biotechnol. 44:127-132(2010)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
