Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ctenocephalides felis Salivary antigen 1

Recombinant Ctenocephalides felis Salivary antigen 1

SKU:CSB-YP835981CTP

Regular price €1.122,95 EUR
Regular price Sale price €1.122,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q94424

Gene Names: N/A

Organism: Ctenocephalides felis (Cat flea)

AA Sequence: EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK

Expression Region: 19-176aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 20.1 kDa

Alternative Name(s): FS-I Allergen: Cte f 1

Relevance:

Reference: "Salivary antigens of Ctenocephalides felis: collection, purification and evaluation by intradermal skin testing in dogs."Frank G.R., Hunter S.W., Wallenfels L.J., Kwochka K.(In) Kwochka K., Von Tscharner C., Willemse T. (eds.); Advances in veterinary dermatology, pp.3:201-212, Butterworth-Heinemann Medical, Oxford (1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details