Gene Bio Systems
Recombinant Cronobacter sakazakii UPF0208 membrane protein ESA_00924 (ESA_00924)
Recombinant Cronobacter sakazakii UPF0208 membrane protein ESA_00924 (ESA_00924)
SKU:CSB-CF419095CXL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Uniprot NO.:A7MH29
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTPENRPVSFFSLFRRGQHYSKTWPTDKRLAPVFIENRVIRATRFAIRIMPPVAVFTLC WQIALGGQLGPAVATALFALSMPMQGLWWLGKRSVTPLPPGTLNWFYEVRTKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Protein Names:Recommended name: UPF0208 membrane protein ESA_00924
Gene Names:Ordered Locus Names:ESA_00924
Expression Region:1-151
Sequence Info:full length protein
