Gene Bio Systems
Recombinant Coxiella burnetii Probable disulfide formation protein(CBU_0888)
Recombinant Coxiella burnetii Probable disulfide formation protein(CBU_0888)
SKU:CSB-CF800838DXP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Uniprot NO.:Q83D55
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMVSRLLKNYSLYFAWLTALIATLGSLYLSLVRHIPVCDLCWYQRVCIYPLTILLGIAAY RTDRGVVKYALPLVVLGFLFSVYQYLQQMIPGFAPINLCGSTSPHCSEIHWEIFGFITLP FLGMLATLIMSFFLIMAFYSLDKRLAN
Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase
Gene Names:Ordered Locus Names:CBU_0888
Expression Region:1-147
Sequence Info:full length protein
