Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium urealyticum UPF0233 membrane protein cu0052 (cu0052)

Recombinant Corynebacterium urealyticum UPF0233 membrane protein cu0052 (cu0052)

SKU:CSB-CF540224DXD

Regular price €1.374,95 EUR
Regular price Sale price €1.374,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)

Uniprot NO.:B1VE23

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKINSPEENFDSSAAAGVDRRTPVKLNASGTPRWYIVIMLGLMLLGLAWLVVNYIAG PAIPLMVTLGPWNYLIGFGLFIVGLLMTMGWK

Protein Names:Recommended name: UPF0233 membrane protein cu0052

Gene Names:Ordered Locus Names:cu0052

Expression Region:1-92

Sequence Info:full length protein

View full details