Skip to product information
1 of 1

Gene Bio Systems

Recombinant Colwellia psychrerythraea UPF0059 membrane protein CPS_3146(CPS_3146)

Recombinant Colwellia psychrerythraea UPF0059 membrane protein CPS_3146(CPS_3146)

SKU:CSB-CF673004CBAB

Regular price €1.469,95 EUR
Regular price Sale price €1.469,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)

Uniprot NO.:Q47ZC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIEVIILAIALSMDAFAVSIGLGATKQQSKVAPLGIIVALYFGLFQGIMPIIGYLGGKGV LSWAESYTPWIAFLLLFLIGVKMIFDSFSEGIEEDISKITHRVLLILAIATSIDAMAAGF SLTLLPVNPLIACLIIASVTFIFSWLGVLVGTKGGTWLENKAEFVGGITLIVMAIKIIIT S

Protein Names:Recommended name: UPF0059 membrane protein CPS_3146

Gene Names:Ordered Locus Names:CPS_3146

Expression Region:1-181

Sequence Info:full length protein

View full details