Gene Bio Systems
Recombinant Colwellia psychrerythraea DNA polymerase IV(dinB)
Recombinant Colwellia psychrerythraea DNA polymerase IV(dinB)
SKU:CSB-EP676401CBABe1
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: dinB
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Colwellia psychrerythraea (strain 34H / ATCC BAA-681)(Vibrio psychroerythus)
Delivery time: 3-7 business days
Uniprot ID: Q487H6
AA Sequence: MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL
Tag info: NO-Tagged
Expression Region: 1-352aa
Protein length: Full Length
MW: 39.3 kDa
Alternative Name(s):
Relevance: Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.
Reference: "The psychrophilic lifestyle as revealed by the genome sequence of Colwellia psychrerythraea 34H through genomic and proteomic analyses." Methe B.A., Nelson K.E., Deming J.W., Momen B., Melamud E., Zhang X., Moult J., Madupu R., Nelson W.C., Dodson R.J., Brinkac L.M., Daugherty S.C., Durkin A.S., DeBoy R.T., Kolonay J.F., Sullivan S.A., Zhou L., Davidsen T.M. Fraser C.M. Proc. Natl. Acad. Sci. U.S.A. 102:10913-10918(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
