Gene Bio Systems
Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP18(TVP18)
Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP18(TVP18)
SKU:CSB-CF625184DUV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coccidioides immitis (strain RS) (Valley fever fungus)
Uniprot NO.:Q1E1E0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLAEEFKSRNFSIYGQWTGVICIILSFAIGLASVFSRFIVFGIISLVYSPLLLFIEVPF LLRICPTSSKFDAFIRRFTTNFMRAAIYAAMSGGLWISLVIDPSSLIAVAVFLAIAGLFY LLAALMKQEFTSSKTLGGQGVAQMIV
Protein Names:Recommended name: Golgi apparatus membrane protein TVP18
Gene Names:Name:TVP18 ORF Names:CIMG_03623
Expression Region:1-146
Sequence Info:full length protein
