Gene Bio Systems
Recombinant Clostridium perfringens UPF0060 membrane protein CPR_1507(CPR_1507)
Recombinant Clostridium perfringens UPF0060 membrane protein CPR_1507(CPR_1507)
SKU:CSB-CF605447CAAP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium perfringens (strain SM101 / Type A)
Uniprot NO.:Q0SST2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MENIKSIFYFLLAGVFEIGGGYLIWLWLRQGKSLIYGIIGALVLILYGIIPTLQPENSNF GRVYATYGGIFIVLSILCGWKVDNIIPDKFDLIGGFIALIGVLIIMYAPRG
Protein Names:Recommended name: UPF0060 membrane protein CPR_1507
Gene Names:Ordered Locus Names:CPR_1507
Expression Region:1-111
Sequence Info:full length protein
