Recombinant Clostridium perfringens N-acetylneuraminate lyase (nanA)

SKU: Q0SWI8

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Metabolism

Uniprot ID: Q0SWI8

Gene Names: nanA

Alternative Name(s): (NAL)(Neu5Ac lyase)(N-acetylneuraminate pyruvate-lyase)(N-acetylneuraminic acid aldolase)(Sialate lyase)(Sialic acid aldolase)(Sialic acid lyase)

Abbreviation: Recombinant Clostridium perfringens nanA protein

Organism: Clostridium perfringens (strain SM101 / Type A)

Source: Yeast

Expression Region: 1-288aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGSTGENFMLSTDEKKRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFNEIKHYYETIINSVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGVKFTAADFYLLERMRKAFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGIRARQIFEAAQKGDIETALEVQHVTNDLITDILNNGLYQTIKLILQEQGVDAGYCRQPMKEATEEMIEKAKEINKKYF

MW: 34.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Catalyzes the reversible aldol cleavage of N-acetylneuraminic acid (sialic acid; Neu5Ac) to form pyruvate and N-acetylmannosamine (ManNAc) via a Schiff base intermediate.

Reference: "Skewed genomic variability in strains of the toxigenic bacterial pathogen, Clostridium perfringens." Myers G.S.A., Rasko D.A., Cheung J.K., Ravel J., Seshadri R., DeBoy R.T., Ren Q., Varga J., Awad M.M., Brinkac L.M., Daugherty S.C., Haft D.H., Dodson R.J., Madupu R., Nelson W.C., Rosovitz M.J., Sullivan S.A., Khouri H. Paulsen I.T. Genome Res. 16: 1031-1040(2006)

Function: