Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)

Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)

SKU:CSB-CF494680DUQ

Regular price €1.441,95 EUR
Regular price Sale price €1.441,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clostridium kluyveri (strain NBRC 12016)

Uniprot NO.:B9E0Q4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESTIILIIILTASVLGRANSVALATCFLLILKLLNADKFIFPYLQENGLFLGLVILIAS ILIPIADGKVSYISIRNVFTSWLGIFALLVSLFTTYLSGLGMNYLTIQGHSEIMPALILG AVIAAAFLGGVPVGPMITSGLIALGLKLFNKIGS

Protein Names:Recommended name: UPF0756 membrane protein CKR_1028

Gene Names:Ordered Locus Names:CKR_1028

Expression Region:1-154

Sequence Info:full length protein

View full details