Gene Bio Systems
Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673)
Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673)
SKU:CSB-CF418776CWW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Uniprot NO.:A7GAZ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Protein Names:Recommended name: UPF0316 protein CLI_0673
Gene Names:Ordered Locus Names:CLI_0673
Expression Region:1-170
Sequence Info:full length protein
