Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium botulinum UPF0059 membrane protein CLK_0733 (CLK_0733)

Recombinant Clostridium botulinum UPF0059 membrane protein CLK_0733 (CLK_0733)

SKU:CSB-CF543258DUI

Regular price €1.480,95 EUR
Regular price Sale price €1.480,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium botulinum (strain Loch Maree / Type A3)

Uniprot NO.:B1L008

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLVSIILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSIKENRDNKDEIACDYAVGEKKCLNNKTLTLLA IATSIDALAIGVSFAFLKVSIINTIIIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGI VLIFIGIKIFIEHTNILSKIF

Protein Names:Recommended name: UPF0059 membrane protein CLK_0733

Gene Names:Ordered Locus Names:CLK_0733

Expression Region:1-201

Sequence Info:full length protein

View full details