Recombinant Clostridium acetobutylicum  ATP synthase subunit a(atpB)

Recombinant Clostridium acetobutylicum ATP synthase subunit a(atpB)

CSB-CF015070DUB
Regular price
€1.094,95 EUR
Sale price
€1.094,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Uniprot NO.:O05097

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELGAKTVFSMKLGSYNFAITETVVLQWIIMAVIILLAIFLTKNLKKVPNRKQSVIEMIV NLINGLVKENMGEKFMNFVPIIGTMAVFILFLNLTGLVGIEPATKDISVTAGFALVSAFL INATAIKRIGVGGYIKSIFSQGPIMVPMNLLEKVTIPVSLCLRLFINMLVGAIVMSLIYS TPAKILLPVPLHGFFDMFDGVLQVYVFVLLTMIFTKLGIEH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Synonyms:atpA Ordered Locus Names:CA_C2871

Expression Region:1-221

Sequence Info:full length protein

Your list is ready to share