Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clavispora lusitaniae Genetic interactor of prohibitin 7, mitochondrial(GEP7)

Recombinant Clavispora lusitaniae Genetic interactor of prohibitin 7, mitochondrial(GEP7)

SKU:CSB-CF505473DTX

Regular price €1.512,95 EUR
Regular price Sale price €1.512,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)

Uniprot NO.:C4XVW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TAGKDSARKLSPEEAKAEAAKLAIQSLKDVGSVFSSGSDDAVQPIDTRPVFENPELFGTL NLLHQGQVLKELQEKYDKNWNKLTDEEKKLGYYIAYGNWGPREKFINWNTQEAPYDLPFR VPSKVRLSNPQANDVVHKLEPLYLSETPVRKEQFDTSKMDPVTKTFIYITLFVMLFAISR DKNTGESGKPQEIIIEDRYMKSKLEKEQKEKEKEIEEENRKNQEKQARRKWYYLWLK

Protein Names:Recommended name: Genetic interactor of prohibitin 7, mitochondrial

Gene Names:Name:GEP7 ORF Names:CLUG_00084

Expression Region:27-263

Sequence Info:full length protein

View full details