Recombinant Citrus unshiu Defender against cell death 1(DAD1)

CSB-CF006487DTR

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu)

Uniprot NO.:Q9ZWQ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARSTGKDAQALFHSLRSAYAATPTTLKIIDLYVGFAVFTALIQVVYMAIVGSFPFNSFL SGVLSCVGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG

Protein Names:Recommended name: Defender against cell death 1 Short name= DAD-1 Alternative name(s): CitDAD-1-1

Gene Names:Name:DAD1

Expression Region:1-115

Sequence Info:full length protein