Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chloroherpeton thalassium NADH-quinone oxidoreductase subunit A 1(nuoA1)

Recombinant Chloroherpeton thalassium NADH-quinone oxidoreductase subunit A 1(nuoA1)

SKU:CSB-CF457453DSY

Regular price €1.395,95 EUR
Regular price Sale price €1.395,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chloroherpeton thalassium (strain ATCC 35110 / GB-78)

Uniprot NO.:B3QUX5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLESYFPIFVVISIAIILAVVLLSIGKIIGPKRNNPEKLTPYESGMDPVGSTRTRVTVRF YLVAMIFIVFDIEVIFMYPWAVSFRELSGFYGLIPMVTFVLILLAGYYYILKKKALDWDE E

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1

Gene Names:Name:nuoA1 Ordered Locus Names:Ctha_2024

Expression Region:1-121

Sequence Info:full length protein

View full details